PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g033620.1
Common NameMTR_1g033620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 245aa    MW: 26300 Da    PI: 10.3905
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g033620.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.53e-0814501147
                     HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Medtr1g033620.1 14 LFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 50
                     6778899*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.2E-101356IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-111453IPR006447Myb domain, plants
PfamPF002493.5E-61450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-51549IPR009057Homeodomain-like
CDDcd001674.95E-42151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSDTPYATAL KALLFLLGLD KYGKGDWRSI SRNFVVTRTP TQVASHAQKY FIRLNSMNKD  60
RRRSSIHDIT SVNNGDVSTP QGPITGQTNG SSGNSAGKSV KQAVPSTTGL PGAGMYAAPT  120
IGQPIGGPLV SAVGTPVNLS APPHMAYGIR APVPGTVVSG APVNMVPMTY PMPHHTSAPH  180
RLLNCYFVKL RSEEVKNQHE NKSGVGEMRM LRWICGKTKR IGLETTTLES WDHTYSRKDG  240
VNEA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.260380.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1350120.0BT135012.1 Medicago truncatula clone JCVI-FLMt-16A6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013466666.10.0myb-like DNA-binding domain, shaqkyf class protein
TrEMBLA0A072VFX50.0A0A072VFX5_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA07G28310.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.13e-59MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]